PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca42374.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NF-YB
Protein Properties Length: 156aa    MW: 17172.5 Da    PI: 4.5088
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca42374.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB79.64.1e-251194386
       NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                ++d+ lP a +++i+k++lPa+ ++++da++++ ec +efi +v+se+++ c++e++kti+++ +l al  lGf dy+e++ + 
  Dca42374.1 11 KEDASLPKATMTKIIKEMLPAEVRVARDAQDLLIECCVEFINLVSSESNEVCNKEEKKTIAPEHVLKALERLGFGDYMEEVYAA 94
                6899**************************************************************************998654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.4E-398140IPR009072Histone-fold
SuperFamilySSF471131.84E-3612142IPR009072Histone-fold
PfamPF008083.0E-221479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MEPMDIVGKT KEDASLPKAT MTKIIKEMLP AEVRVARDAQ DLLIECCVEF INLVSSESNE  60
VCNKEEKKTI APEHVLKALE RLGFGDYMEE VYAAYEQHKI ETMQDGVRGG KLGNGGAEMT  120
EEEAAAEQQR MFAEARARMN GGAPLAKPEA HGTSEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B7e-371213612133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012092932.11e-89PREDICTED: protein Dr1 homolog isoform X1
RefseqXP_006288820.11e-89hypothetical protein CARUB_v10002155mg
SwissprotP495921e-88NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A067J8H81e-89A0A067J8H8_JATCU; Uncharacterized protein
TrEMBLR0HD872e-89R0HD87_9BRAS; Uncharacterized protein
STRINGGLYMA05G07750.13e-88(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08190.15e-71nuclear factor Y, subunit B12